Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) |
Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins) |
Domain d2hs4a4: 2hs4 A:508-603 [136719] Other proteins in same PDB: d2hs4a1, d2hs4a2, d2hs4a3 automated match to d1vk3a4 complexed with acp, fgr, mg, po4 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 2hs4 (more details), 2.7 Å
SCOPe Domain Sequences for d2hs4a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hs4a4 d.139.1.1 (A:508-603) Phosphoribosylformylglycinamidine synthase II, domain 4 {Thermotoga maritima [TaxId: 2336]} akpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthvetfreyglki evklpevrpahqmvlvfsertpvvdvpvkeigtlsr
Timeline for d2hs4a4: