Lineage for d2hs4a3 (2hs4 A:167-345)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978140Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2978141Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2978142Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)
  6. 2978173Protein Phosphoribosylformylglycinamidine synthase II, domain 2 [419052] (1 species)
    protein duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 2978174Species Thermotoga maritima [TaxId:2336] [419543] (7 PDB entries)
    TM1246
  8. 2978178Domain d2hs4a3: 2hs4 A:167-345 [136718]
    Other proteins in same PDB: d2hs4a1, d2hs4a2, d2hs4a4
    automated match to d1vk3a3
    complexed with acp, fgr, mg, po4

Details for d2hs4a3

PDB Entry: 2hs4 (more details), 2.7 Å

PDB Description: T. maritima PurL complexed with FGAR and AMPPCP
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d2hs4a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hs4a3 d.139.1.1 (A:167-345) Phosphoribosylformylglycinamidine synthase II, domain 2 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgihgasfasedltgdkatklsiqvgdpfaekmlieaflemv
eeglvegaqdlgaggvlsatselvakgnlgaivhldrvplrepdmepweilisesqerma
vvtspqkasrileiarkhllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi

SCOPe Domain Coordinates for d2hs4a3:

Click to download the PDB-style file with coordinates for d2hs4a3.
(The format of our PDB-style files is described here.)

Timeline for d2hs4a3: