Lineage for d2hs4a1 (2hs4 A:2-166)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865651Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 866010Superfamily d.79.4: PurM N-terminal domain-like [55326] (1 family) (S)
  5. 866011Family d.79.4.1: PurM N-terminal domain-like [55327] (6 proteins)
  6. 866026Protein Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 [103082] (1 species)
    duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 866027Species Thermotoga maritima [TaxId:2336] [103083] (7 PDB entries)
    TM1246
  8. 866032Domain d2hs4a1: 2hs4 A:2-166 [136716]
    Other proteins in same PDB: d2hs4a3, d2hs4a4
    automatically matched to d1vk3a1
    complexed with acp, fgr, mg, po4

Details for d2hs4a1

PDB Entry: 2hs4 (more details), 2.7 Å

PDB Description: T. maritima PurL complexed with FGAR and AMPPCP
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOP Domain Sequences for d2hs4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hs4a1 d.79.4.1 (A:2-166) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]}
klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgfegnagvvnldd
yysvafkieshnhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiieg
iadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvds

SCOP Domain Coordinates for d2hs4a1:

Click to download the PDB-style file with coordinates for d2hs4a1.
(The format of our PDB-style files is described here.)

Timeline for d2hs4a1: