SCOPe 2.01: Domain d2hs3a4: 2hs3 A:508-603

Lineage for d2hs3a4 (2hs3 A:508-603)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)

6. Protein Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 [103260] (1 species)
   duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer

7. Species Thermotoga maritima [TaxId:2336] [103261] (7 PDB entries)
   TM1246

8. Domain d2hs3a4: 2hs3 A:508-603 [136715]
   Other proteins in same PDB: d2hs3a1, d2hs3a2
   automatically matched to d1vk3a4
   complexed with fgr, po4

Details for d2hs3a4

PDB Entry: 2hs3, 2.3 Å

PDB Description: T. maritima PurL complexed with FGAR

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d2hs3a4:

Sequence; same for both SEQRES and ATOM records:

>d2hs3a4 d.139.1.1 (A:508-603) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]}
akpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthvetfreyglki
evklpevrpahqmvlvfsertpvvdvpvkeigtlsr

Timeline for d2hs3a4:

• d2hs3a4 first appeared in SCOP 1.73
  
• d2hs3a4 appears in SCOP 1.75
  
• d2hs3a4 appears in SCOPe 2.02
  
• d2hs3a4 appears in the current release, SCOPe 2.08