Lineage for d2hs3a2 (2hs3 A:346-507)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960238Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 2960239Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. 2960275Protein Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 [103082] (1 species)
    duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 2960276Species Thermotoga maritima [TaxId:2336] [103083] (7 PDB entries)
    TM1246
  8. 2960280Domain d2hs3a2: 2hs3 A:346-507 [136713]
    Other proteins in same PDB: d2hs3a3, d2hs3a4
    automated match to d1vk3a2
    complexed with fgr, po4

Details for d2hs3a2

PDB Entry: 2hs3 (more details), 2.3 Å

PDB Description: T. maritima PurL complexed with FGAR
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d2hs3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hs3a2 d.79.4.1 (A:346-507) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]}
veytpgkipefkrvefeevnarevfeqydhmvgtdtvvppgfgaavmrikrdggyslvth
sradlalqdtywgtliavlesvrktlsvgaeplaitncvnygdpdvdpvglsammtalkn
acefsgvpvasgnaslyntyqgkpipptlvvgmlgkvnpqkv

SCOPe Domain Coordinates for d2hs3a2:

Click to download the PDB-style file with coordinates for d2hs3a2.
(The format of our PDB-style files is described here.)

Timeline for d2hs3a2: