Lineage for d2hs3a1 (2hs3 A:2-166)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914717Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 1914718Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. 1914745Protein Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 [103082] (1 species)
    duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 1914746Species Thermotoga maritima [TaxId:2336] [103083] (7 PDB entries)
    TM1246
  8. 1914749Domain d2hs3a1: 2hs3 A:2-166 [136712]
    Other proteins in same PDB: d2hs3a3, d2hs3a4
    automated match to d1vk3a1
    complexed with fgr, po4

Details for d2hs3a1

PDB Entry: 2hs3 (more details), 2.3 Å

PDB Description: T. maritima PurL complexed with FGAR
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d2hs3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hs3a1 d.79.4.1 (A:2-166) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]}
klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgfegnagvvnldd
yysvafkieshnhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiieg
iadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvds

SCOPe Domain Coordinates for d2hs3a1:

Click to download the PDB-style file with coordinates for d2hs3a1.
(The format of our PDB-style files is described here.)

Timeline for d2hs3a1: