Lineage for d2hs0a4 (2hs0 A:508-603)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928072Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 1928073Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 1928074Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)
  6. 1928101Protein Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 [103260] (1 species)
    duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 1928102Species Thermotoga maritima [TaxId:2336] [103261] (7 PDB entries)
    TM1246
  8. 1928108Domain d2hs0a4: 2hs0 A:508-603 [136711]
    Other proteins in same PDB: d2hs0a1, d2hs0a2
    automated match to d1vk3a4
    complexed with atp, mg

Details for d2hs0a4

PDB Entry: 2hs0 (more details), 2.52 Å

PDB Description: T. maritima PurL complexed with ATP
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d2hs0a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hs0a4 d.139.1.1 (A:508-603) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]}
akpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthvetfreyglki
evklpevrpahqmvlvfsertpvvdvpvkeigtlsr

SCOPe Domain Coordinates for d2hs0a4:

Click to download the PDB-style file with coordinates for d2hs0a4.
(The format of our PDB-style files is described here.)

Timeline for d2hs0a4: