| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) ![]() |
| Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins) |
| Protein Phosphoribosylformylglycinamidine synthase II, domain 2 [419052] (1 species) protein duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer |
| Species Thermotoga maritima [TaxId:2336] [419543] (7 PDB entries) TM1246 |
| Domain d2hs0a3: 2hs0 A:167-345 [136710] Other proteins in same PDB: d2hs0a1, d2hs0a2, d2hs0a4 automated match to d1vk3a3 complexed with atp, mg |
PDB Entry: 2hs0 (more details), 2.52 Å
SCOPe Domain Sequences for d2hs0a3:
Sequence, based on SEQRES records: (download)
>d2hs0a3 d.139.1.1 (A:167-345) Phosphoribosylformylglycinamidine synthase II, domain 2 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgihgasfasedltgdkatklsiqvgdpfaekmlieaflemv
eeglvegaqdlgaggvlsatselvakgnlgaivhldrvplrepdmepweilisesqerma
vvtspqkasrileiarkhllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi
>d2hs0a3 d.139.1.1 (A:167-345) Phosphoribosylformylglycinamidine synthase II, domain 2 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgiiqvgdpfaekmlieaflemveeglvegaqdlgaggvlsa
tselvakgnlgaivhldrvplrepdmepweilisesqermavvtspqkasrileiarkhl
lfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi
Timeline for d2hs0a3: