![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
![]() | Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family) ![]() |
![]() | Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins) |
![]() | Protein Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 [103260] (1 species) duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer |
![]() | Species Thermotoga maritima [TaxId:2336] [103261] (7 PDB entries) TM1246 |
![]() | Domain d2hrya3: 2hry A:167-345 [136706] Other proteins in same PDB: d2hrya1, d2hrya2 automatically matched to d1vk3a3 complexed with acp, mg, po4 |
PDB Entry: 2hry (more details), 2.8 Å
SCOPe Domain Sequences for d2hrya3:
Sequence, based on SEQRES records: (download)
>d2hrya3 d.139.1.1 (A:167-345) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]} kasrpgqvivifggatgrdgihgasfasedltgdkatklsiqvgdpfaekmlieaflemv eeglvegaqdlgaggvlsatselvakgnlgaivhldrvplrepdmepweilisesqerma vvtspqkasrileiarkhllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi
>d2hrya3 d.139.1.1 (A:167-345) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]} kasrpgqvivifggatgrdgivgdpfaekmlieaflemveeglvegaqdlgaggvlsats elvakgnlgaivhldrvplrepdmepweilisesqermavvtspqkasrileiarkhllf gdvvaevieepvyrvmyrndlvmevpvqllanapeedi
Timeline for d2hrya3: