Lineage for d2hrua3 (2hru A:167-345)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1041476Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 1041477Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family) (S)
  5. 1041478Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)
  6. 1041493Protein Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 [103260] (1 species)
    duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 1041494Species Thermotoga maritima [TaxId:2336] [103261] (7 PDB entries)
    TM1246
  8. 1041505Domain d2hrua3: 2hru A:167-345 [136701]
    Other proteins in same PDB: d2hrua1, d2hrua2
    automatically matched to d1vk3a3
    complexed with adp, mg

Details for d2hrua3

PDB Entry: 2hru (more details), 2.8 Å

PDB Description: t. maritima purl complexed with adp
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d2hrua3:

Sequence, based on SEQRES records: (download)

>d2hrua3 d.139.1.1 (A:167-345) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgihgasfasedltgdkatklsiqvgdpfaekmlieaflemv
eeglvegaqdlgaggvlsatselvakgnlgaivhldrvplrepdmepweilisesqerma
vvtspqkasrileiarkhllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi

Sequence, based on observed residues (ATOM records): (download)

>d2hrua3 d.139.1.1 (A:167-345) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgivgdpfaekmlieaflemveeglvegaqdlgaggvlsats
elvakgnlgaivhldrvplrepdmepweilisesqermavvtspqkasrileiarkhllf
gdvvaevieepvyrvmyrndlvmevpvqllanapeedi

SCOPe Domain Coordinates for d2hrua3:

Click to download the PDB-style file with coordinates for d2hrua3.
(The format of our PDB-style files is described here.)

Timeline for d2hrua3: