SCOP 1.73: Domain d2hrua3: 2hru A:167-345

Lineage for d2hrua3 (2hru A:167-345)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (4 proteins)

6. Protein Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 [103260] (1 species)
   duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer

7. Species Thermotoga maritima [TaxId:2336] [103261] (6 PDB entries)
   TM1246

8. Domain d2hrua3: 2hru A:167-345 [136701]
   Other proteins in same PDB: d2hrua1, d2hrua2
   automatically matched to d1vk3a3
   complexed with adp, mg; mutant

Details for d2hrua3

PDB Entry: 2hru, 2.8 Å

PDB Description: t. maritima purl complexed with adp

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOP Domain Sequences for d2hrua3:

Sequence, based on SEQRES records:

>d2hrua3 d.139.1.1 (A:167-345) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgihgasfasedltgdkatklsiqvgdpfaekmlieaflemv
eeglvegaqdlgaggvlsatselvakgnlgaivhldrvplrepdmepweilisesqerma
vvtspqkasrileiarkhllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi

Sequence, based on observed residues (ATOM records):

>d2hrua3 d.139.1.1 (A:167-345) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgivgdpfaekmlieaflemveeglvegaqdlgaggvlsats
elvakgnlgaivhldrvplrepdmepweilisesqermavvtspqkasrileiarkhllf
gdvvaevieepvyrvmyrndlvmevpvqllanapeedi

Timeline for d2hrua3:

• d2hrua3 is new in SCOP 1.73
  
• d2hrua3 appears in SCOP 1.75
  
• d2hrua3 appears in the current release, SCOPe 2.08