SCOPe 2.06: Domain d2hrua1: 2hru A:2-166

Lineage for d2hrua1 (2hru A:2-166)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families)

5. Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)

6. Protein Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 [103082] (1 species)
   duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer

7. Species Thermotoga maritima [TaxId:2336] [103083] (7 PDB entries)
   TM1246

8. Domain d2hrua1: 2hru A:2-166 [136699]
   Other proteins in same PDB: d2hrua3, d2hrua4
   automated match to d1vk3a1
   complexed with adp, mg

Details for d2hrua1

PDB Entry: 2hru, 2.8 Å

PDB Description: t. maritima purl complexed with adp

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d2hrua1:

Sequence; same for both SEQRES and ATOM records:

>d2hrua1 d.79.4.1 (A:2-166) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]}
klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgfegnagvvnldd
yysvafkiesanhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiieg
iadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvds

Timeline for d2hrua1:

• d2hrua1 first appeared in SCOP 1.73
  
• d2hrua1 appears in SCOPe 2.05
  
• d2hrua1 appears in SCOPe 2.07
  
• d2hrua1 appears in the current release, SCOPe 2.08