SCOPe 2.06: Domain d2hrqf_: 2hrq F:

Lineage for d2hrqf_ (2hrq F:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
   automatically mapped to Pfam PF00135

6. Protein automated matches [190065] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186857] (44 PDB entries)

8. Domain d2hrqf_: 2hrq F: [136695]
   automated match to d1mx1a_
   complexed with gd7, nag, sia, so4, suc

Details for d2hrqf_

PDB Entry: 2hrq, 2.7 Å

PDB Description: crystal structure of human liver carboxylesterase 1 (hce1) in covalent complex with the nerve agent soman (gd)

PDB Compounds: (F:) Liver carboxylesterase 1

SCOPe Domain Sequences for d2hrqf_:

Sequence; same for both SEQRES and ATOM records:

>d2hrqf_ c.69.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvknat
syppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwihg
gglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwv
qdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgdv
kplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllgt
vidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsll
wksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdaga
ptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwan
farngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak

Timeline for d2hrqf_:

• d2hrqf_ first appeared in SCOP 1.73, called d2hrqf1
  
• d2hrqf_ appears in SCOPe 2.05
  
• d2hrqf_ appears in SCOPe 2.07
  
• d2hrqf_ appears in the current release, SCOPe 2.08