Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins) automatically mapped to Pfam PF00135 |
Protein automated matches [190065] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186857] (38 PDB entries) |
Domain d2hrqf_: 2hrq F: [136695] automated match to d1mx1a_ complexed with gd7, nag, sia, so4, suc |
PDB Entry: 2hrq (more details), 2.7 Å
SCOPe Domain Sequences for d2hrqf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hrqf_ c.69.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvknat syppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwihg gglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwv qdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgdv kplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllgt vidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsll wksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdaga ptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwan farngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
Timeline for d2hrqf_: