Lineage for d2hrqf1 (2hrq F:6022-6553)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 841868Family c.69.1.1: Acetylcholinesterase-like [53475] (5 proteins)
  6. 842027Protein Mammalian carboxylesterase (liver carboxylesterase I) [75282] (2 species)
  7. 842028Species Human (Homo sapiens) [TaxId:9606] [89768] (13 PDB entries)
  8. 842049Domain d2hrqf1: 2hrq F:6022-6553 [136695]
    automatically matched to d1mx9d_
    complexed with gd7, nag, sia, so4, suc

Details for d2hrqf1

PDB Entry: 2hrq (more details), 2.7 Å

PDB Description: crystal structure of human liver carboxylesterase 1 (hce1) in covalent complex with the nerve agent soman (gd)
PDB Compounds: (F:) Liver carboxylesterase 1

SCOP Domain Sequences for d2hrqf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrqf1 c.69.1.1 (F:6022-6553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]}
sppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvknat
syppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwihg
gglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwv
qdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgdv
kplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllgt
vidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsll
wksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdaga
ptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwan
farngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak

SCOP Domain Coordinates for d2hrqf1:

Click to download the PDB-style file with coordinates for d2hrqf1.
(The format of our PDB-style files is described here.)

Timeline for d2hrqf1: