SCOP 1.73: Domain d2hrqf1: 2hrq F:6022-6553

Lineage for d2hrqf1 (2hrq F:6022-6553)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.1: Acetylcholinesterase-like [53475] (5 proteins)

6. Protein Mammalian carboxylesterase (liver carboxylesterase I) [75282] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89768] (13 PDB entries)

8. Domain d2hrqf1: 2hrq F:6022-6553 [136695]
   automatically matched to d1mx9d_
   complexed with gd7, nag, sia, so4, suc

Details for d2hrqf1

PDB Entry: 2hrq, 2.7 Å

PDB Description: crystal structure of human liver carboxylesterase 1 (hce1) in covalent complex with the nerve agent soman (gd)

PDB Compounds: (F:) Liver carboxylesterase 1

SCOP Domain Sequences for d2hrqf1:

Sequence; same for both SEQRES and ATOM records:

>d2hrqf1 c.69.1.1 (F:6022-6553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]}
sppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvknat
syppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwihg
gglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwv
qdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgdv
kplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllgt
vidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsll
wksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdaga
ptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwan
farngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak

Timeline for d2hrqf1:

• d2hrqf1 is new in SCOP 1.73
  
• d2hrqf1 appears in SCOP 1.75
  
• d2hrqf1 appears in the current release, SCOPe 2.08, called d2hrqf_