SCOPe 2.01: Domain d2hrqc_: 2hrq C:

Lineage for d2hrqc_ (2hrq C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)

6. Protein automated matches [190065] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186857] (24 PDB entries)

8. Domain d2hrqc_: 2hrq C: [136692]
   automated match to d1mx1a_
   complexed with gd7, nag, sia, so4, suc

Details for d2hrqc_

PDB Entry: 2hrq, 2.7 Å

PDB Description: crystal structure of human liver carboxylesterase 1 (hce1) in covalent complex with the nerve agent soman (gd)

PDB Compounds: (C:) Liver carboxylesterase 1

SCOPe Domain Sequences for d2hrqc_:

Sequence; same for both SEQRES and ATOM records:

>d2hrqc_ c.69.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvknat
syppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwihg
gglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwv
qdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgdv
kplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllgt
vidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsll
wksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdaga
ptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwan
farngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak

Timeline for d2hrqc_:

• d2hrqc_ first appeared in SCOP 1.73, called d2hrqc1
  
• d2hrqc_ was called d2hrqc1 in SCOP 1.75
  
• d2hrqc_ appears in SCOPe 2.02
  
• d2hrqc_ appears in the current release, SCOPe 2.08