![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) [89176] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89177] (6 PDB entries) |
![]() | Domain d2hrla_: 2hrl A: [136689] automated match to d1o7va_ complexed with ceq, nag |
PDB Entry: 2hrl (more details), 1.85 Å
SCOPe Domain Sequences for d2hrla_:
Sequence, based on SEQRES records: (download)
>d2hrla_ b.1.1.1 (A:) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} dysltmqssvtvqegmcvhvrcsfsypvdsqtdsdpvhgywfragndiswkapvatnnpa wavqeetrdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydqlsvnvt
>d2hrla_ b.1.1.1 (A:) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} dysltmqssvtvqegmcvhvrcsfsypvdsdpvhgywfragndiswkapvatnnpawavq eetrdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydqlsvnvt
Timeline for d2hrla_: