Lineage for d2hrla_ (2hrl A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019378Protein N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) [89176] (1 species)
  7. 2019379Species Human (Homo sapiens) [TaxId:9606] [89177] (6 PDB entries)
  8. 2019383Domain d2hrla_: 2hrl A: [136689]
    automated match to d1o7va_
    complexed with ceq, nag

Details for d2hrla_

PDB Entry: 2hrl (more details), 1.85 Å

PDB Description: Siglec-7 in complex with GT1b
PDB Compounds: (A:) Sialic acid-binding Ig-like lectin 7

SCOPe Domain Sequences for d2hrla_:

Sequence, based on SEQRES records: (download)

>d2hrla_ b.1.1.1 (A:) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]}
dysltmqssvtvqegmcvhvrcsfsypvdsqtdsdpvhgywfragndiswkapvatnnpa
wavqeetrdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydqlsvnvt

Sequence, based on observed residues (ATOM records): (download)

>d2hrla_ b.1.1.1 (A:) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]}
dysltmqssvtvqegmcvhvrcsfsypvdsdpvhgywfragndiswkapvatnnpawavq
eetrdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydqlsvnvt

SCOPe Domain Coordinates for d2hrla_:

Click to download the PDB-style file with coordinates for d2hrla_.
(The format of our PDB-style files is described here.)

Timeline for d2hrla_: