Lineage for d2hrca_ (2hrc A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2160864Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2160865Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 2160866Family c.92.1.1: Ferrochelatase [53801] (2 proteins)
    automatically mapped to Pfam PF00762
  6. 2160867Protein Ferrochelatase [53802] (3 species)
  7. 2160889Species Human (Homo sapiens) [TaxId:9606] [64189] (21 PDB entries)
  8. 2160896Domain d2hrca_: 2hrc A: [136687]
    automated match to d1hrka_
    complexed with chd, cl, fes, gol, imd

Details for d2hrca_

PDB Entry: 2hrc (more details), 1.7 Å

PDB Description: 1.7 angstrom structure of human ferrochelatase variant r115l
PDB Compounds: (A:) Ferrochelatase

SCOPe Domain Sequences for d2hrca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrca_ c.92.1.1 (A:) Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]}
rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapfiakrltpkiqeqyr
rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
vgpmpwlgpqtdesikglcergrknillvpiaftsdhietlyeldieysqvlakecgven
irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql

SCOPe Domain Coordinates for d2hrca_:

Click to download the PDB-style file with coordinates for d2hrca_.
(The format of our PDB-style files is described here.)

Timeline for d2hrca_: