Lineage for d2hrca1 (2hrc A:65-423)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710253Fold c.92: Chelatase-like [53799] (2 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 710254Superfamily c.92.1: Chelatase [53800] (3 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 710255Family c.92.1.1: Ferrochelatase [53801] (1 protein)
  6. 710256Protein Ferrochelatase [53802] (3 species)
  7. 710270Species Human (Homo sapiens) [TaxId:9606] [64189] (2 PDB entries)
  8. 710271Domain d2hrca1: 2hrc A:65-423 [136687]
    automatically matched to d1hrka_
    complexed with chd, cl, fes, gol, imd; mutant

Details for d2hrca1

PDB Entry: 2hrc (more details), 1.7 Å

PDB Description: 1.7 angstrom structure of human ferrochelatase variant r115l
PDB Compounds: (A:) Ferrochelatase

SCOP Domain Sequences for d2hrca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrca1 c.92.1.1 (A:65-423) Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]}
rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapfiakrltpkiqeqyr
rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
vgpmpwlgpqtdesikglcergrknillvpiaftsdhietlyeldieysqvlakecgven
irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql

SCOP Domain Coordinates for d2hrca1:

Click to download the PDB-style file with coordinates for d2hrca1.
(The format of our PDB-style files is described here.)

Timeline for d2hrca1: