SCOPe 2.04: Domain d2hr9a_: 2hr9 A:

Lineage for d2hr9a_ (2hr9 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.88: Mss4-like [51315] (2 superfamilies)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.1: Mss4-like [51316] (4 families)
   duplication: tandem repeat of two similar structural motifs

5. Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins)
   contains an insertion of alpha helical hairpin; lacks zinc-binding site
   automatically mapped to Pfam PF00838

6. Protein Translationally controlled tumor protein TCTP (histamine-releasing factor) [63874] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117337] (2 PDB entries)
   Uniprot P13693

8. Domain d2hr9a_: 2hr9 A: [136686]
   automated match to d2hr9a1

Details for d2hr9a_

PDB Entry: 2hr9

PDB Description: solution structure of human translationally controlled tumor protein

PDB Compounds: (A:) Translationally-controlled tumor protein

SCOPe Domain Sequences for d2hr9a_:

Sequence; same for both SEQRES and ATOM records:

>d2hr9a_ b.88.1.2 (A:) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]}
miiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpege
gtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtgaae
qikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekcle

Timeline for d2hr9a_:

• d2hr9a_ first appeared in SCOP 1.73, called d2hr9a1
  
• d2hr9a_ was called d2hr9a1 in SCOPe 2.03
  
• d2hr9a_ appears in SCOPe 2.05
  
• d2hr9a_ appears in the current release, SCOPe 2.08, called d2hr9a2