![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.88: Mss4-like [51315] (1 superfamily) complex fold made of several coiled beta-sheets |
![]() | Superfamily b.88.1: Mss4-like [51316] (4 families) ![]() duplication: tandem repeat of two similar structural motifs |
![]() | Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins) contains an insertion of alpha helical hairpin; lacks zinc-binding site automatically mapped to Pfam PF00838 |
![]() | Protein Translationally controlled tumor protein TCTP (histamine-releasing factor) [63874] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117337] (2 PDB entries) Uniprot P13693 |
![]() | Domain d2hr9a1: 2hr9 A:1-174 [136686] automatically matched to d1y41a_ |
PDB Entry: 2hr9 (more details)
SCOPe Domain Sequences for d2hr9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hr9a1 b.88.1.2 (A:1-174) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]} miiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpege gtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtgaae qikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekcle
Timeline for d2hr9a1: