Lineage for d2hr9a1 (2hr9 A:1-174)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1140140Fold b.88: Mss4-like [51315] (1 superfamily)
    complex fold made of several coiled beta-sheets
  4. 1140141Superfamily b.88.1: Mss4-like [51316] (4 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 1140151Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins)
    contains an insertion of alpha helical hairpin; lacks zinc-binding site
  6. 1140152Protein Translationally controlled tumor protein TCTP (histamine-releasing factor) [63874] (3 species)
  7. 1140156Species Human (Homo sapiens) [TaxId:9606] [117337] (2 PDB entries)
    Uniprot P13693
  8. 1140161Domain d2hr9a1: 2hr9 A:1-174 [136686]
    automatically matched to d1y41a_

Details for d2hr9a1

PDB Entry: 2hr9 (more details)

PDB Description: solution structure of human translationally controlled tumor protein
PDB Compounds: (A:) Translationally-controlled tumor protein

SCOPe Domain Sequences for d2hr9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hr9a1 b.88.1.2 (A:1-174) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]}
miiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpege
gtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtgaae
qikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekcle

SCOPe Domain Coordinates for d2hr9a1:

Click to download the PDB-style file with coordinates for d2hr9a1.
(The format of our PDB-style files is described here.)

Timeline for d2hr9a1: