SCOP 1.73: Domain d2hr9a1: 2hr9 A:1-174

Lineage for d2hr9a1 (2hr9 A:1-174)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.88: Mss4-like [51315] (1 superfamily)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.1: Mss4-like [51316] (4 families)
   duplication: tandem repeat of two similar structural motifs

5. Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (1 protein)
   contains an insertion of alpha helical hairpin; lacks zinc-binding site

6. Protein Translationally controlled tumor protein TCTP (histamine-releasing factor) [63874] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117337] (2 PDB entries)

8. Domain d2hr9a1: 2hr9 A:1-174 [136686]
   automatically matched to d1y41a_

Details for d2hr9a1

PDB Entry: 2hr9

PDB Description: solution structure of human translationally controlled tumor protein

PDB Compounds: (A:) Translationally-controlled tumor protein

SCOP Domain Sequences for d2hr9a1:

Sequence; same for both SEQRES and ATOM records:

>d2hr9a1 b.88.1.2 (A:1-174) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]}
miiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpege
gtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtgaae
qikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekcle

Timeline for d2hr9a1:

• d2hr9a1 is new in SCOP 1.73
  
• d2hr9a1 appears in SCOP 1.75
  
• d2hr9a1 appears in the current release, SCOPe 2.08, called d2hr9a2