SCOPe 2.08: Domain d2hr9a2: 2hr9 A:1-172

Lineage for d2hr9a2 (2hr9 A:1-172)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.88: Mss4-like [51315] (2 superfamilies)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.1: Mss4-like [51316] (5 families)
   duplication: tandem repeat of two similar structural motifs

5. Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins)
   contains an insertion of alpha helical hairpin; lacks zinc-binding site
   automatically mapped to Pfam PF00838

6. Protein Translationally controlled tumor protein TCTP (histamine-releasing factor) [63874] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117337] (6 PDB entries)
   Uniprot P13693

8. Domain d2hr9a2: 2hr9 A:1-172 [136686]
   Other proteins in same PDB: d2hr9a3
   automated match to d2hr9a1

Details for d2hr9a2

PDB Entry: 2hr9

PDB Description: solution structure of human translationally controlled tumor protein

PDB Compounds: (A:) Translationally-controlled tumor protein

SCOPe Domain Sequences for d2hr9a2:

Sequence; same for both SEQRES and ATOM records:

>d2hr9a2 b.88.1.2 (A:1-172) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]}
miiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpege
gtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtgaae
qikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekc

Timeline for d2hr9a2:

• d2hr9a2 first appeared in SCOP 1.73, called d2hr9a1
  
• d2hr9a2 appears in SCOPe 2.07