Lineage for d2hr5a2 (2hr5 A:135-171)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464186Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1464187Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1464289Protein Rubrerythrin, C-terminal domain [57811] (2 species)
  7. 1464301Species Pyrococcus furiosus [TaxId:2261] [103622] (2 PDB entries)
  8. 1464304Domain d2hr5a2: 2hr5 A:135-171 [136683]
    Other proteins in same PDB: d2hr5a1, d2hr5b1
    automated match to d1nnqa2
    complexed with fe

Details for d2hr5a2

PDB Entry: 2hr5 (more details), 2.7 Å

PDB Description: PF1283- Rubrerythrin from Pyrococcus furiosus iron bound form
PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d2hr5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hr5a2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
eikkvyicpicgytavdeapeycpvcgapkekfvvfe

SCOPe Domain Coordinates for d2hr5a2:

Click to download the PDB-style file with coordinates for d2hr5a2.
(The format of our PDB-style files is described here.)

Timeline for d2hr5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hr5a1