Lineage for d2hr5a1 (2hr5 A:2-134)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702238Protein Rubrerythrin, N-terminal domain [47242] (2 species)
  7. 2702250Species Pyrococcus furiosus [TaxId:2261] [101129] (2 PDB entries)
  8. 2702251Domain d2hr5a1: 2hr5 A:2-134 [136682]
    Other proteins in same PDB: d2hr5a2, d2hr5b2
    automated match to d1nnqa1
    complexed with fe

Details for d2hr5a1

PDB Entry: 2hr5 (more details), 2.7 Å

PDB Description: PF1283- Rubrerythrin from Pyrococcus furiosus iron bound form
PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d2hr5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hr5a1 a.25.1.1 (A:2-134) Rubrerythrin, N-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedi

SCOPe Domain Coordinates for d2hr5a1:

Click to download the PDB-style file with coordinates for d2hr5a1.
(The format of our PDB-style files is described here.)

Timeline for d2hr5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hr5a2