Lineage for d2hr3c_ (2hr3 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693716Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693754Protein Probable transcriptional regulator PA3067 [140243] (1 species)
  7. 2693755Species Pseudomonas aeruginosa [TaxId:287] [140244] (1 PDB entry)
    Uniprot Q9HZE1 2-146
  8. 2693758Domain d2hr3c_: 2hr3 C: [136680]
    automated match to d2hr3a1

Details for d2hr3c_

PDB Entry: 2hr3 (more details), 2.4 Å

PDB Description: crystal structure of putative transcriptional regulator protein from pseudomonas aeruginosa pa01 at 2.4 a resolution
PDB Compounds: (C:) probable transcriptional regulator

SCOPe Domain Sequences for d2hr3c_:

Sequence, based on SEQRES records: (download)

>d2hr3c_ a.4.5.28 (C:) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]}
tnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaaerm
rssnlaallrelergglivrhadpqdgrrtrvslssegrrnlygnrakreewlvramhac
ldeserallaaagplltrlaqfe

Sequence, based on observed residues (ATOM records): (download)

>d2hr3c_ a.4.5.28 (C:) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]}
tnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaaerm
rssnlaallrelergglivrhadrtrvslssegrrnlygnrakreewlvramhacldese
rallaaagplltrlaqfe

SCOPe Domain Coordinates for d2hr3c_:

Click to download the PDB-style file with coordinates for d2hr3c_.
(The format of our PDB-style files is described here.)

Timeline for d2hr3c_: