Lineage for d2hr3b_ (2hr3 B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. Protein Probable transcriptional regulator PA3067 [140243] (1 species)
  7. Species Pseudomonas aeruginosa [TaxId:287] [140244] (1 PDB entry)
    Uniprot Q9HZE1 2-146
  8. Domain d2hr3b_: 2hr3 B: [136679]
    automated match to d2hr3a1

Details for d2hr3b_

PDB Entry: 2hr3 (more details), 2.4 Å

PDB Description: Crystal structure of putative transcriptional regulator protein from Pseudomonas aeruginosa PA01 at 2.4 A resolution
PDB Compounds: (B:) probable transcriptional regulator

SCOPe Domain Sequences for d2hr3b_:

Sequence, based on SEQRES records: (download)

>d2hr3b_ a.4.5.28 (B:) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]}
tnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaaerm
rssnlaallrelergglivrhadpqdgrrtrvslssegrrnlygnrakreewlvramhac
ldeserallaaagplltrlaqfe

Sequence, based on observed residues (ATOM records): (download)

>d2hr3b_ a.4.5.28 (B:) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]}
tnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaaerm
rssnlaallrelergglivrhtrvslssegrrnlygnrakreewlvramhacldeseral
laaagplltrlaqfe

SCOPe Domain Coordinates for d2hr3b_ are not available.

Timeline for d2hr3b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hr3a1, d2hr3c_, d2hr3d_