SCOPe 2.08: Domain d2hr3b_: 2hr3 B:

Lineage for d2hr3b_ (2hr3 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Probable transcriptional regulator PA3067 [140243] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [140244] (1 PDB entry)
   Uniprot Q9HZE1 2-146

8. Domain d2hr3b_: 2hr3 B: [136679]
   automated match to d2hr3a1

Details for d2hr3b_

PDB Entry: 2hr3, 2.4 Å

PDB Description: crystal structure of putative transcriptional regulator protein from pseudomonas aeruginosa pa01 at 2.4 a resolution

PDB Compounds: (B:) probable transcriptional regulator

SCOPe Domain Sequences for d2hr3b_:

Sequence, based on SEQRES records:

>d2hr3b_ a.4.5.28 (B:) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]}
tnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaaerm
rssnlaallrelergglivrhadpqdgrrtrvslssegrrnlygnrakreewlvramhac
ldeserallaaagplltrlaqfe

Sequence, based on observed residues (ATOM records):

>d2hr3b_ a.4.5.28 (B:) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]}
tnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaaerm
rssnlaallrelergglivrhtrvslssegrrnlygnrakreewlvramhacldeseral
laaagplltrlaqfe

Timeline for d2hr3b_:

• d2hr3b_ first appeared in SCOP 1.73, called d2hr3b1
  
• d2hr3b_ appears in SCOPe 2.07