Lineage for d2hr3a1 (2hr3 A:2-146)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762443Family a.4.5.28: MarR-like transcriptional regulators [63379] (19 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 762477Protein Probable transcriptional regulator PA3067 [140243] (1 species)
  7. 762478Species Pseudomonas aeruginosa [TaxId:287] [140244] (1 PDB entry)
    Uniprot Q9HZE1 2-146
  8. 762479Domain d2hr3a1: 2hr3 A:2-146 [136678]

Details for d2hr3a1

PDB Entry: 2hr3 (more details), 2.4 Å

PDB Description: crystal structure of putative transcriptional regulator protein from pseudomonas aeruginosa pa01 at 2.4 a resolution
PDB Compounds: (A:) probable transcriptional regulator

SCOP Domain Sequences for d2hr3a1:

Sequence, based on SEQRES records: (download)

>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]}
ptnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaaer
mrssnlaallrelergglivrhadpqdgrrtrvslssegrrnlygnrakreewlvramha
cldeserallaaagplltrlaqfee

Sequence, based on observed residues (ATOM records): (download)

>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]}
ptnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaaer
mrssnlaallrelergglivrhartrvslssegrrnlygnrakreewlvramhacldese
rallaaagplltrlaqfee

SCOP Domain Coordinates for d2hr3a1:

Click to download the PDB-style file with coordinates for d2hr3a1.
(The format of our PDB-style files is described here.)

Timeline for d2hr3a1: