Lineage for d2hr3a1 (2hr3 A:2-146)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982915Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 protein domains)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 1982953Protein Probable transcriptional regulator PA3067 [140243] (1 species)
  7. 1982954Species Pseudomonas aeruginosa [TaxId:287] [140244] (1 PDB entry)
    Uniprot Q9HZE1 2-146
  8. 1982955Domain d2hr3a1: 2hr3 A:2-146 [136678]

Details for d2hr3a1

PDB Entry: 2hr3 (more details), 2.4 Å

PDB Description: Crystal structure of putative transcriptional regulator protein from Pseudomonas aeruginosa PA01 at 2.4 A resolution
PDB Compounds: (A:) probable transcriptional regulator

SCOPe Domain Sequences for d2hr3a1:

Sequence, based on SEQRES records: (download)

>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]}
ptnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaaer
mrssnlaallrelergglivrhadpqdgrrtrvslssegrrnlygnrakreewlvramha
cldeserallaaagplltrlaqfee

Sequence, based on observed residues (ATOM records): (download)

>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]}
ptnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaaer
mrssnlaallrelergglivrhartrvslssegrrnlygnrakreewlvramhacldese
rallaaagplltrlaqfee

SCOPe Domain Coordinates for d2hr3a1:

Click to download the PDB-style file with coordinates for d2hr3a1.
(The format of our PDB-style files is described here.)

Timeline for d2hr3a1: