Lineage for d2hqsh_ (2hqs H:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1658417Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 1658418Family d.79.7.1: OmpA-like [103089] (3 proteins)
    Pfam PF00691
  6. 1658427Protein automated matches [190318] (2 species)
    not a true protein
  7. 1658428Species Escherichia coli [TaxId:562] [187135] (2 PDB entries)
  8. 1658432Domain d2hqsh_: 2hqs H: [136673]
    Other proteins in same PDB: d2hqsa1, d2hqsa2, d2hqsb1, d2hqsb2, d2hqsd1, d2hqsd2, d2hqsf1, d2hqsf2
    automated match to d1oapa_
    complexed with act, gol, so4

Details for d2hqsh_

PDB Entry: 2hqs (more details), 1.5 Å

PDB Description: crystal structure of tolb/pal complex
PDB Compounds: (H:) peptidoglycan-associated lipoprotein

SCOPe Domain Sequences for d2hqsh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hqsh_ d.79.7.1 (H:) automated matches {Escherichia coli [TaxId: 562]}
qnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerra
navkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvyl

SCOPe Domain Coordinates for d2hqsh_:

Click to download the PDB-style file with coordinates for d2hqsh_.
(The format of our PDB-style files is described here.)

Timeline for d2hqsh_: