Lineage for d2hqsh1 (2hqs H:68-173)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865651Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 866149Superfamily d.79.7: OmpA-like [103088] (1 family) (S)
  5. 866150Family d.79.7.1: OmpA-like [103089] (2 proteins)
    Pfam PF00691
  6. 866154Protein Peptidoglycan-associated lipoprotein, PAL, periplasmic domain [103090] (2 species)
  7. 866155Species Escherichia coli [TaxId:562] [103091] (2 PDB entries)
  8. 866159Domain d2hqsh1: 2hqs H:68-173 [136673]
    Other proteins in same PDB: d2hqsa1, d2hqsa2, d2hqsb1, d2hqsb2, d2hqsd1, d2hqsd2, d2hqsf1, d2hqsf2
    automatically matched to d1oapa_
    complexed with act, gol, so4

Details for d2hqsh1

PDB Entry: 2hqs (more details), 1.5 Å

PDB Description: Crystal structure of TolB/Pal complex
PDB Compounds: (H:) peptidoglycan-associated lipoprotein

SCOP Domain Sequences for d2hqsh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hqsh1 d.79.7.1 (H:68-173) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Escherichia coli [TaxId: 562]}
nnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerran
avkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvy

SCOP Domain Coordinates for d2hqsh1:

Click to download the PDB-style file with coordinates for d2hqsh1.
(The format of our PDB-style files is described here.)

Timeline for d2hqsh1: