Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.7: OmpA-like [103088] (1 family) |
Family d.79.7.1: OmpA-like [103089] (2 proteins) Pfam PF00691 |
Protein Peptidoglycan-associated lipoprotein, PAL, periplasmic domain [103090] (2 species) |
Species Escherichia coli [TaxId:562] [103091] (2 PDB entries) |
Domain d2hqsh1: 2hqs H:68-173 [136673] Other proteins in same PDB: d2hqsa1, d2hqsa2, d2hqsb1, d2hqsb2, d2hqsd1, d2hqsd2, d2hqsf1, d2hqsf2 automatically matched to d1oapa_ complexed with act, gol, so4 |
PDB Entry: 2hqs (more details), 1.5 Å
SCOP Domain Sequences for d2hqsh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hqsh1 d.79.7.1 (H:68-173) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Escherichia coli [TaxId: 562]} nnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerran avkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvy
Timeline for d2hqsh1: