Lineage for d2hqsh2 (2hqs H:67-173)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960608Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2960609Family d.79.7.1: OmpA-like [103089] (3 proteins)
    Pfam PF00691
  6. 2960618Protein automated matches [190318] (2 species)
    not a true protein
  7. 2960619Species Escherichia coli [TaxId:562] [187135] (2 PDB entries)
  8. 2960623Domain d2hqsh2: 2hqs H:67-173 [136673]
    Other proteins in same PDB: d2hqsa1, d2hqsa2, d2hqsa3, d2hqsb1, d2hqsb2, d2hqsb3, d2hqsc3, d2hqsd1, d2hqsd2, d2hqsd3, d2hqse3, d2hqsf1, d2hqsf2, d2hqsf3, d2hqsg3, d2hqsh3
    automated match to d1oapa_
    complexed with act, gol, so4

Details for d2hqsh2

PDB Entry: 2hqs (more details), 1.5 Å

PDB Description: crystal structure of tolb/pal complex
PDB Compounds: (H:) peptidoglycan-associated lipoprotein

SCOPe Domain Sequences for d2hqsh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hqsh2 d.79.7.1 (H:67-173) automated matches {Escherichia coli [TaxId: 562]}
qnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerra
navkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvy

SCOPe Domain Coordinates for d2hqsh2:

Click to download the PDB-style file with coordinates for d2hqsh2.
(The format of our PDB-style files is described here.)

Timeline for d2hqsh2: