| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.7: OmpA-like [103088] (2 families) ![]() |
| Family d.79.7.1: OmpA-like [103089] (3 proteins) Pfam PF00691 |
| Protein automated matches [190318] (1 species) not a true protein |
| Species Escherichia coli [TaxId:562] [187135] (2 PDB entries) |
| Domain d2hqsg_: 2hqs G: [136672] Other proteins in same PDB: d2hqsa1, d2hqsa2, d2hqsb1, d2hqsb2, d2hqsd1, d2hqsd2, d2hqsf1, d2hqsf2 automated match to d1oapa_ complexed with act, gol, so4 |
PDB Entry: 2hqs (more details), 1.5 Å
SCOPe Domain Sequences for d2hqsg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hqsg_ d.79.7.1 (G:) automated matches {Escherichia coli [TaxId: 562]}
qnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerra
navkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvyl
Timeline for d2hqsg_: