Lineage for d2hqsf1 (2hqs F:163-431)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2065584Superfamily b.68.4: TolB, C-terminal domain [50960] (1 family) (S)
  5. 2065585Family b.68.4.1: TolB, C-terminal domain [50961] (2 protein domains)
  6. 2065586Protein TolB, C-terminal domain [50962] (1 species)
  7. 2065587Species Escherichia coli [TaxId:562] [50963] (4 PDB entries)
  8. 2065591Domain d2hqsf1: 2hqs F:163-431 [136670]
    Other proteins in same PDB: d2hqsa2, d2hqsa3, d2hqsb2, d2hqsb3, d2hqsc2, d2hqsc3, d2hqsd2, d2hqsd3, d2hqse2, d2hqse3, d2hqsf2, d2hqsf3, d2hqsg2, d2hqsg3, d2hqsh2, d2hqsh3
    automated match to d2hqsa1
    complexed with act, gol, so4

Details for d2hqsf1

PDB Entry: 2hqs (more details), 1.5 Å

PDB Description: Crystal structure of TolB/Pal complex
PDB Compounds: (F:) protein tolb

SCOPe Domain Sequences for d2hqsf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hqsf1 b.68.4.1 (F:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}
afrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvtfes
grsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasgqir
qvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdadvss
dgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmgsvl
nlvstdgrfkarlpatdgqvkfpawspyl

SCOPe Domain Coordinates for d2hqsf1:

Click to download the PDB-style file with coordinates for d2hqsf1.
(The format of our PDB-style files is described here.)

Timeline for d2hqsf1: