Lineage for d2hqsd2 (2hqs D:24-162)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489766Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2489935Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families) (S)
  5. 2489936Family c.51.2.1: TolB, N-terminal domain [52965] (1 protein)
  6. 2489937Protein TolB, N-terminal domain [52966] (1 species)
  7. 2489938Species Escherichia coli [TaxId:562] [52967] (4 PDB entries)
  8. 2489941Domain d2hqsd2: 2hqs D:24-162 [136668]
    Other proteins in same PDB: d2hqsa1, d2hqsa3, d2hqsb1, d2hqsb3, d2hqsc2, d2hqsc3, d2hqsd1, d2hqsd3, d2hqse2, d2hqse3, d2hqsf1, d2hqsf3, d2hqsg2, d2hqsg3, d2hqsh2, d2hqsh3
    automated match to d2hqsa2
    complexed with act, gol, so4

Details for d2hqsd2

PDB Entry: 2hqs (more details), 1.5 Å

PDB Description: crystal structure of tolb/pal complex
PDB Compounds: (D:) protein tolb

SCOPe Domain Sequences for d2hqsd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hqsd2 c.51.2.1 (D:24-162) TolB, N-terminal domain {Escherichia coli [TaxId: 562]}
vrividsgvdsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgs
aqevqpaawsalgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlr
yaghtasdevfekltgikg

SCOPe Domain Coordinates for d2hqsd2:

Click to download the PDB-style file with coordinates for d2hqsd2.
(The format of our PDB-style files is described here.)

Timeline for d2hqsd2: