Lineage for d2hqsc1 (2hqs C:68-173)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727288Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 727695Superfamily d.79.7: OmpA-like [103088] (1 family) (S)
  5. 727696Family d.79.7.1: OmpA-like [103089] (2 proteins)
    Pfam PF00691
  6. 727700Protein Peptidoglycan-associated lipoprotein, PAL, periplasmic domain [103090] (2 species)
  7. 727701Species Escherichia coli [TaxId:562] [103091] (2 PDB entries)
  8. 727702Domain d2hqsc1: 2hqs C:68-173 [136666]
    Other proteins in same PDB: d2hqsa1, d2hqsa2, d2hqsb1, d2hqsb2, d2hqsd1, d2hqsd2, d2hqsf1, d2hqsf2
    automatically matched to d1oapa_
    complexed with act, gol, so4

Details for d2hqsc1

PDB Entry: 2hqs (more details), 1.5 Å

PDB Description: crystal structure of tolb/pal complex
PDB Compounds: (C:) peptidoglycan-associated lipoprotein

SCOP Domain Sequences for d2hqsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hqsc1 d.79.7.1 (C:68-173) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Escherichia coli [TaxId: 562]}
nnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerran
avkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvy

SCOP Domain Coordinates for d2hqsc1:

Click to download the PDB-style file with coordinates for d2hqsc1.
(The format of our PDB-style files is described here.)

Timeline for d2hqsc1: