| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families) ![]() |
| Family c.51.2.1: TolB, N-terminal domain [52965] (1 protein) |
| Protein TolB, N-terminal domain [52966] (1 species) |
| Species Escherichia coli [TaxId:562] [52967] (4 PDB entries) |
| Domain d2hqsb2: 2hqs B:29-162 [136665] Other proteins in same PDB: d2hqsa1, d2hqsb1, d2hqsc_, d2hqsd1, d2hqse_, d2hqsf1, d2hqsg_, d2hqsh_ automatically matched to d1crza2 complexed with act, gol, so4 |
PDB Entry: 2hqs (more details), 1.5 Å
SCOPe Domain Sequences for d2hqsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hqsb2 c.51.2.1 (B:29-162) TolB, N-terminal domain {Escherichia coli [TaxId: 562]}
dsgvdsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgsaqevq
paawsalgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaght
asdevfekltgikg
Timeline for d2hqsb2: