Lineage for d2hqsb1 (2hqs B:163-431)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 807413Superfamily b.68.4: TolB, C-terminal domain [50960] (1 family) (S)
  5. 807414Family b.68.4.1: TolB, C-terminal domain [50961] (1 protein)
  6. 807415Protein TolB, C-terminal domain [50962] (1 species)
  7. 807416Species Escherichia coli [TaxId:562] [50963] (4 PDB entries)
  8. 807418Domain d2hqsb1: 2hqs B:163-431 [136664]
    Other proteins in same PDB: d2hqsa2, d2hqsb2, d2hqsc1, d2hqsd2, d2hqse1, d2hqsf2, d2hqsg1, d2hqsh1
    automatically matched to d1c5ka1
    complexed with act, gol, so4

Details for d2hqsb1

PDB Entry: 2hqs (more details), 1.5 Å

PDB Description: crystal structure of tolb/pal complex
PDB Compounds: (B:) protein tolb

SCOP Domain Sequences for d2hqsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hqsb1 b.68.4.1 (B:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}
afrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvtfes
grsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasgqir
qvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdadvss
dgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmgsvl
nlvstdgrfkarlpatdgqvkfpawspyl

SCOP Domain Coordinates for d2hqsb1:

Click to download the PDB-style file with coordinates for d2hqsb1.
(The format of our PDB-style files is described here.)

Timeline for d2hqsb1: