Lineage for d2hqsa2 (2hqs A:29-162)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835189Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 835307Superfamily c.51.2: TolB, N-terminal domain [52964] (1 family) (S)
  5. 835308Family c.51.2.1: TolB, N-terminal domain [52965] (1 protein)
  6. 835309Protein TolB, N-terminal domain [52966] (1 species)
  7. 835310Species Escherichia coli [TaxId:562] [52967] (4 PDB entries)
  8. 835311Domain d2hqsa2: 2hqs A:29-162 [136663]
    Other proteins in same PDB: d2hqsa1, d2hqsb1, d2hqsc1, d2hqsd1, d2hqse1, d2hqsf1, d2hqsg1, d2hqsh1
    automatically matched to d1crza2
    complexed with act, gol, so4

Details for d2hqsa2

PDB Entry: 2hqs (more details), 1.5 Å

PDB Description: crystal structure of tolb/pal complex
PDB Compounds: (A:) protein tolb

SCOP Domain Sequences for d2hqsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hqsa2 c.51.2.1 (A:29-162) TolB, N-terminal domain {Escherichia coli [TaxId: 562]}
dsgvdsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgsaqevq
paawsalgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaght
asdevfekltgikg

SCOP Domain Coordinates for d2hqsa2:

Click to download the PDB-style file with coordinates for d2hqsa2.
(The format of our PDB-style files is described here.)

Timeline for d2hqsa2: