Lineage for d2hq9b_ (2hq9 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1792693Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 1792694Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 1792695Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 1792742Protein Hypothetical protein Mll6688 [141354] (1 species)
    binds FAD cofactor
  7. 1792743Species Mesorhizobium loti [TaxId:381] [141355] (1 PDB entry)
    Uniprot Q988L5 1-148
  8. 1792745Domain d2hq9b_: 2hq9 B: [136660]
    automated match to d2hq9a1
    complexed with cl, edo, fad

Details for d2hq9b_

PDB Entry: 2hq9 (more details), 1.95 Å

PDB Description: crystal structure of a fad-binding protein (mll6688) from mesorhizobium loti at 1.95 a resolution
PDB Compounds: (B:) Mll6688 protein

SCOPe Domain Sequences for d2hq9b_:

Sequence, based on SEQRES records: (download)

>d2hq9b_ b.45.1.1 (B:) Hypothetical protein Mll6688 {Mesorhizobium loti [TaxId: 381]}
mlvrtlsalectkvltanrvgrlacakdgqpyvvplyyaysdahlyafsmpgkkiewmra
nprvsvqvdehgqgrgwksvvvdgryeelpdlighklqrdhawsvlskhtdwwepgalkp
vtpptadsaphvffrilieqvsgreas

Sequence, based on observed residues (ATOM records): (download)

>d2hq9b_ b.45.1.1 (B:) Hypothetical protein Mll6688 {Mesorhizobium loti [TaxId: 381]}
mlvrtlsalectkvltanrvgrlacakdgqpyvvplyyaysdahlyafsmpgkkiewmra
nprvsvqvdehgqgrgwksvvvdgryeelpdlighklqrdhawsvlskhtdwwepgalsa
phvffrilieqvsgreas

SCOPe Domain Coordinates for d2hq9b_:

Click to download the PDB-style file with coordinates for d2hq9b_.
(The format of our PDB-style files is described here.)

Timeline for d2hq9b_: