SCOP 1.73: Domain d2hq9b1: 2hq9 B:1-147

Lineage for d2hq9b1 (2hq9 B:1-147)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.45: Split barrel-like [50474] (2 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (3 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (16 proteins)

6. Protein Hypothetical protein Mll6688 [141354] (1 species)
   binds FAD cofactor

7. Species Mesorhizobium loti [TaxId:381] [141355] (1 PDB entry)

8. Domain d2hq9b1: 2hq9 B:1-147 [136660]
   automatically matched to 2HQ9 A:1-148
   complexed with cl, edo, fad

Details for d2hq9b1

PDB Entry: 2hq9, 1.95 Å

PDB Description: crystal structure of a fad-binding protein (mll6688) from mesorhizobium loti at 1.95 a resolution

PDB Compounds: (B:) Mll6688 protein

SCOP Domain Sequences for d2hq9b1:

Sequence, based on SEQRES records:

>d2hq9b1 b.45.1.1 (B:1-147) Hypothetical protein Mll6688 {Mesorhizobium loti [TaxId: 381]}
mlvrtlsalectkvltanrvgrlacakdgqpyvvplyyaysdahlyafsmpgkkiewmra
nprvsvqvdehgqgrgwksvvvdgryeelpdlighklqrdhawsvlskhtdwwepgalkp
vtpptadsaphvffrilieqvsgreas

Sequence, based on observed residues (ATOM records):

>d2hq9b1 b.45.1.1 (B:1-147) Hypothetical protein Mll6688 {Mesorhizobium loti [TaxId: 381]}
mlvrtlsalectkvltanrvgrlacakdgqpyvvplyyaysdahlyafsmpgkkiewmra
nprvsvqvdehgqgrgwksvvvdgryeelpdlighklqrdhawsvlskhtdwwepgalsa
phvffrilieqvsgreas

Timeline for d2hq9b1:

• d2hq9b1 is new in SCOP 1.73
  
• d2hq9b1 appears in SCOP 1.75
  
• d2hq9b1 appears in the current release, SCOPe 2.08, called d2hq9b_