Lineage for d2hq9a1 (2hq9 A:1-148)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794134Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 2794183Protein Hypothetical protein Mll6688 [141354] (1 species)
    binds FAD cofactor
  7. 2794184Species Mesorhizobium loti [TaxId:381] [141355] (1 PDB entry)
    Uniprot Q988L5 1-148
  8. 2794185Domain d2hq9a1: 2hq9 A:1-148 [136659]
    Other proteins in same PDB: d2hq9a2
    complexed with cl, edo, fad

Details for d2hq9a1

PDB Entry: 2hq9 (more details), 1.95 Å

PDB Description: crystal structure of a fad-binding protein (mll6688) from mesorhizobium loti at 1.95 a resolution
PDB Compounds: (A:) Mll6688 protein

SCOPe Domain Sequences for d2hq9a1:

Sequence, based on SEQRES records: (download)

>d2hq9a1 b.45.1.1 (A:1-148) Hypothetical protein Mll6688 {Mesorhizobium loti [TaxId: 381]}
mlvrtlsalectkvltanrvgrlacakdgqpyvvplyyaysdahlyafsmpgkkiewmra
nprvsvqvdehgqgrgwksvvvdgryeelpdlighklqrdhawsvlskhtdwwepgalkp
vtpptadsaphvffrilieqvsgrease

Sequence, based on observed residues (ATOM records): (download)

>d2hq9a1 b.45.1.1 (A:1-148) Hypothetical protein Mll6688 {Mesorhizobium loti [TaxId: 381]}
mlvrtlsalectkvltanrvgrlacakdgqpyvvplyyaysdahlyafsmpgkkiewmra
nprvsvqvdehgqgrgwksvvvdgryeelpdlighklqrdhawsvlskhtdwweaphvff
rilieqvsgrease

SCOPe Domain Coordinates for d2hq9a1:

Click to download the PDB-style file with coordinates for d2hq9a1.
(The format of our PDB-style files is described here.)

Timeline for d2hq9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hq9a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2hq9b_