Lineage for d2hq7b1 (2hq7 B:2-142)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669990Fold b.45: Split barrel-like [50474] (2 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 669991Superfamily b.45.1: FMN-binding split barrel [50475] (3 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 669992Family b.45.1.1: PNP-oxidase like [50476] (16 proteins)
  6. 670019Protein Hypotheical protein CAC3491 [141360] (1 species)
    related to general stress protein 26(GS26) of B.subtilis
  7. 670020Species Clostridium acetobutylicum [TaxId:1488] [141361] (1 PDB entry)
  8. 670022Domain d2hq7b1: 2hq7 B:2-142 [136658]
    automatically matched to 2HQ7 A:2-142
    complexed with cl, edo

Details for d2hq7b1

PDB Entry: 2hq7 (more details), 2 Å

PDB Description: crystal structure of protein related to general stress protein 26(gs26) of b.subtilis (pyridoxinephosphate oxidase family) (np_350077.1) from clostridium acetobutylicum at 2.00 a resolution
PDB Compounds: (B:) Protein, related to general stress protein 26(GS26) of B.subtilis

SCOP Domain Sequences for d2hq7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hq7b1 b.45.1.1 (B:2-142) Hypotheical protein CAC3491 {Clostridium acetobutylicum [TaxId: 1488]}
idekfliesnelvesskivmvgtngengypnikammrlkhdglkkfwlstntstrmverl
kknnkiclyfvddnkfaglmlvgtieilhdraskemlwtdgceiyyplgiddpdytalcf
taewgnyyrhlknitfkidei

SCOP Domain Coordinates for d2hq7b1:

Click to download the PDB-style file with coordinates for d2hq7b1.
(The format of our PDB-style files is described here.)

Timeline for d2hq7b1: