![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
![]() | Protein Hypotheical protein CAC3491 [141360] (1 species) related to general stress protein 26(GS26) of B.subtilis |
![]() | Species Clostridium acetobutylicum [TaxId:1488] [141361] (1 PDB entry) Uniprot Q97DI6 2-142 |
![]() | Domain d2hq7b_: 2hq7 B: [136658] automated match to d2hq7a1 complexed with cl, edo |
PDB Entry: 2hq7 (more details), 2 Å
SCOPe Domain Sequences for d2hq7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hq7b_ b.45.1.1 (B:) Hypotheical protein CAC3491 {Clostridium acetobutylicum [TaxId: 1488]} idekfliesnelvesskivmvgtngengypnikammrlkhdglkkfwlstntstrmverl kknnkiclyfvddnkfaglmlvgtieilhdraskemlwtdgceiyyplgiddpdytalcf taewgnyyrhlknitfkideiy
Timeline for d2hq7b_: