![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
![]() | Fold e.62: Heme iron utilization protein-like [144063] (1 superfamily) 2 domains; d1 - 3-helical bundle similar to the homeodomain-like fold; d2 - 6-stranded beta-barrel capped by two helices at one end, similar topology to the PH-like fold |
![]() | Superfamily e.62.1: Heme iron utilization protein-like [144064] (3 families) ![]() |
![]() | Family e.62.1.1: HemS/ChuS-like [144065] (2 proteins) Pfam PF05171; Haemin-degrading proteins; duplication: consists of thandem repeat of this fold joined at the 'free' ends of their PH-like barrels |
![]() | Protein Heme oxygenase ChuS [144068] (1 species) |
![]() | Species Escherichia coli O157:H7 [TaxId:83334] [144069] (3 PDB entries) Uniprot Q8X5N8 1-337 |
![]() | Domain d2hq2a1: 2hq2 A:1-337 [136656] complexed with hem |
PDB Entry: 2hq2 (more details), 1.45 Å
SCOPe Domain Sequences for d2hq2a1:
Sequence, based on SEQRES records: (download)
>d2hq2a1 e.62.1.1 (A:1-337) Heme oxygenase ChuS {Escherichia coli O157:H7 [TaxId: 83334]} mnhytrwlelkeqnpgkyardiaglmnireaelafarvthdawrmhgdireilaalesvg etkcicrneyavheqvgtftnqhlnghaglilnpraldlrlflnqwasvfhikentarge rqsiqffdhqgdallkvyatdntdmaawsellarfitdentplelkavdapvvqtradat vveqewramtdvhqfftllkrhnltrqqafnlvaddlackvsnsalaqilesaqqdgnei mvfvgnrgcvqiftgvvekvvpmkgwlnifnptftlhlleesiaeawvtrkptsdgyvts lelfahdgtqiaqlygqrtegeqeqaqwrkqiaslip
>d2hq2a1 e.62.1.1 (A:1-337) Heme oxygenase ChuS {Escherichia coli O157:H7 [TaxId: 83334]} mnhytrwlelkeqnpgkyardiaglmnireaelafarvthdawrmhgdireilaalesvg etkcicrneyavheqvgtftnqhlnghaglilnpraldlrlflnqwasvfhikentarge rqsiqffdhqgdallkvyatdntdmaawsellarfitdentplelkavradatvveqewr amtdvhqfftllkrhnltrqqafnlvaddlackvsnsalaqilesaqqdgneimvfvgnr gcvqiftgvvekvvpmkgwlnifnptftlhlleesiaeawvtrkptsdgyvtslelfahd gtqiaqlygqrtegeqeqaqwrkqiaslip
Timeline for d2hq2a1: