![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
![]() | Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) ![]() Pfam PF13853. Phylogeny described in PubMed 12761335 |
![]() | Family f.13.1.2: Rhodopsin-like [81320] (2 proteins) Individual TM segments have a number of kinks and distortions |
![]() | Protein automated matches [190300] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [188510] (18 PDB entries) |
![]() | Domain d2hpya_: 2hpy A: [136653] automated match to d1f88a_ complexed with hg, htg, hto, plm, ret, zn |
PDB Entry: 2hpy (more details), 2.8 Å
SCOPe Domain Sequences for d2hpya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hpya_ f.13.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes attqkaekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsav ynpviyimmnkqfrncmvttlccgknplgddeasttvsktetsqvapa
Timeline for d2hpya_: